Loading...
Statistics
Advertisement

IMS Services - HOME
www.imsservices.biz/
Dienstleistungsunternehmen für die Bereiche Arbeitsschutz, Brandschutz, Hygiene und Qualitätsmanagement DIN EN 9001:2015

Imsservices.biz

Advertisement
Conversion Technology Metas Server
Imsservices.biz is hosted in Germany / Berlin . Imsservices.biz doesn't use HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 11. First javascripts: Beng-proxy.js, Jquery.js, Prototype.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.31 (Unix).

Technologies in use by Imsservices.biz

Technology

Number of occurences: 7
  • CSS
  • Font Awesome
  • Html
  • Javascript
  • jQuery
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 11
  • beng-proxy.js
  • jquery.js
  • prototype.js
  • jshelper.js
  • url.js
  • html.js
  • prototype_impl.js
  • widget-runtime@3.26.2.js
  • slideshow-common@3.26.2.js
  • doubletaptogo.js
  • show.js

Server Type

  • Apache/2.2.31 (Unix)

Powered by

  • PHP/5.6.22

CDN

Number of occurences: 1
  • CloudFront

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Imsservices.biz

Missing HTTPS protocol.

    Meta - Imsservices.biz

    Number of occurences: 4
    • Name:
      Content: /HOME/
    • Name: description
      Content: Dienstleistungsunternehmen für die Bereiche Arbeitsschutz, Brandschutz, Hygiene und Qualitätsmanagement DIN EN 9001:2015
    • Name: keywords
      Content: Dienstleistung Arbeitsschutz Hygiene Brandschutz QM DIN EN 9001 Schutzaufgaben Arbeitssicherheit
    • Name: viewport
      Content: width=device-width, initial-scale=1

    Server / Hosting

    • IP: 81.169.145.90
    • Latitude: 52.52
    • Longitude: 13.40
    • Country: Germany
    • City: Berlin

    Rname

    • docks09.rzone.de
    • shades15.rzone.de
    • smtpin.rzone.de

    Target

    • hostmaster.strato-rz.de

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 29 Jun 2016 05:32:11 GMT Server: Apache/2.2.31 (Unix) X-Powered-By: PHP/5.6.22 p3p: CP="CAO PSA OUR" Cache-Control: no-store Set-Cookie: beng_proxy_session=002ff2ccc005dcfb; HttpOnly; Path=/; Version=1; Discard Content-Type: text/html X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

    DNS

    host: imsservices.biz
    1. class: IN
    2. ttl: 150
    3. type: A
    4. ip: 81.169.145.90
    host: imsservices.biz
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: docks09.rzone.de
    host: imsservices.biz
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: shades15.rzone.de
    host: imsservices.biz
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: shades15.rzone.de
    5. rname: hostmaster.strato-rz.de
    6. serial: 2016022702
    7. refresh: 86400
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 7200
    host: imsservices.biz
    1. class: IN
    2. ttl: 150
    3. type: MX
    4. pri: 5
    5. target: smtpin.rzone.de
    host: imsservices.biz
    1. class: IN
    2. ttl: 150
    3. type: AAAA
    4. ipv6: 2a01:238:20a:202:1090::

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.msservices.biz, www.irmsservices.biz, www.rmsservices.biz, www.ifmsservices.biz, www.fmsservices.biz, www.ivmsservices.biz, www.vmsservices.biz, www.ikmsservices.biz, www.kmsservices.biz, www.i,msservices.biz, www.,msservices.biz, www.ibmsservices.biz, www.bmsservices.biz, www.igmsservices.biz, www.gmsservices.biz, www.itmsservices.biz, www.tmsservices.biz, www.iymsservices.biz, www.ymsservices.biz, www.iumsservices.biz, www.umsservices.biz, www.ijmsservices.biz, www.jmsservices.biz, www.immsservices.biz, www.mmsservices.biz, www.inmsservices.biz, www.nmsservices.biz, www.isservices.biz, www.impsservices.biz, www.ipsservices.biz, www.imosservices.biz, www.iosservices.biz, www.imisservices.biz, www.iisservices.biz, www.imksservices.biz, www.iksservices.biz, www.im.sservices.biz, www.i.sservices.biz, www.imusservices.biz, www.iusservices.biz, www.imjsservices.biz, www.ijsservices.biz, www.imnsservices.biz, www.insservices.biz, www.im-sservices.biz, www.i-sservices.biz, www.imservices.biz, www.imseservices.biz, www.imeservices.biz, www.imswservices.biz, www.imwservices.biz, www.imsdservices.biz, www.imdservices.biz, www.imsxservices.biz, www.imxservices.biz, www.imsfservices.biz, www.imfservices.biz, www.imsgservices.biz, www.imgservices.biz, www.imstservices.biz, www.imtservices.biz, www.imservices.biz, www.imsseervices.biz, www.imseervices.biz, www.imsswervices.biz, www.imswervices.biz, www.imssdervices.biz, www.imsdervices.biz, www.imssxervices.biz, www.imsxervices.biz, www.imssfervices.biz, www.imsfervices.biz, www.imssgervices.biz, www.imsgervices.biz, www.imsstervices.biz, www.imstervices.biz, www.imssrvices.biz, www.imssxrvices.biz, www.imssesrvices.biz, www.imsssrvices.biz, www.imssewrvices.biz, www.imsswrvices.biz, www.imsserrvices.biz, www.imssrrvices.biz, www.imssefrvices.biz, www.imssfrvices.biz, www.imssevrvices.biz, www.imssvrvices.biz, www.imssecrvices.biz, www.imsscrvices.biz, www.imsseqrvices.biz, www.imssqrvices.biz, www.imssearvices.biz, www.imssarvices.biz, www.imsseyrvices.biz, www.imssyrvices.biz, www.imssevices.biz, www.imsserivices.biz, www.imsseivices.biz, www.imsserovices.biz, www.imsseovices.biz, www.imsserlvices.biz, www.imsselvices.biz, www.imsserlvices.biz, www.imsselvices.biz, www.imsser.vices.biz, www.imsse.vices.biz, www.imsserices.biz, www.imsservyices.biz, www.imsseryices.biz, www.imsservzices.biz, www.imsserzices.biz, www.imsservhices.biz, www.imsserhices.biz, www.imsservnices.biz, www.imssernices.biz, www.imsservmices.biz, www.imssermices.biz, www.imsservjices.biz, www.imsserjices.biz, www.imsservkices.biz, www.imsserkices.biz, www.imsserviices.biz, www.imsseriices.biz, www.imsservces.biz, www.imsservirces.biz, www.imsservrces.biz, www.imsservifces.biz, www.imsservfces.biz, www.imsservivces.biz, www.imsservvces.biz, www.imsservikces.biz, www.imsservkces.biz, www.imsservi,ces.biz, www.imsserv,ces.biz, www.imsservibces.biz, www.imsservbces.biz, www.imsservigces.biz, www.imsservgces.biz, www.imsservitces.biz, www.imsservtces.biz, www.imsserviyces.biz, www.imsservyces.biz, www.imsserviuces.biz, www.imsservuces.biz, www.imsservijces.biz, www.imsservjces.biz, www.imsservimces.biz, www.imsservmces.biz, www.imsservinces.biz, www.imsservnces.biz, www.imsservies.biz, www.imsservicdes.biz, www.imsservides.biz, www.imsservicres.biz, www.imsservires.biz, www.imsservictes.biz, www.imsservites.biz, www.imsservicves.biz, www.imsservives.biz, www.imsservicfes.biz, www.imsservifes.biz, www.imsservicges.biz, www.imsserviges.biz, www.imsserviches.biz, www.imsservihes.biz, www.imsservicnes.biz, www.imsservines.biz, www.imsservicmes.biz, www.imsservimes.biz, www.imsservicjes.biz, www.imsservijes.biz,

    Other websites we recently analyzed

    1. www.casasillinois.com
      Scottsdale (United States) - 184.168.221.26
      Server software: Microsoft-IIS/7.5
      Technology: Html
    2. Private Krankenversicherung - Kostenloses Angebot zur privaten Krankenversicherung anfordern
      Private Krankenversicherung - Kostenloses Angebot zur privaten Krankenversicherung anfordern
      Germany - 31.185.110.57
      Server software: Apache/2.4.10 (Debian)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 3
    3. RankUp Running
      New York (United States) - 104.236.221.201
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery UI, Php, Facebook Box
      Number of Javascript: 9
      Number of meta tags: 2
    4. landwirtschaftliche-direktvermarktung.de
      Germany - 82.165.89.168
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    5. seakayakbrands.com
      New York (United States) - 69.172.201.153
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    6. IVY'S ATTIC - Englewood, Florida Furniture Store
      IVY'S ATTIC Englewood, Florida selection of sofas, recliners, chairs, tables, accent tables, dining furniture, office furniture, living room furniture, bedroom furniture and more.
      Boardman (United States) - 52.26.98.107
      Server software: Microsoft-IIS/8.5
      Technology: Google Adsense, CSS, Html, Javascript, jQuery Cycle, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 2
    7. topsecurityfilesafe.com
      Scottsdale (United States) - 184.168.221.35
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. mdluxuryrealestateagent.com
      Scottsdale (United States) - 184.168.221.60
      Server software: squid/3.5.6
      Technology: Html, Html5, Iframe, Php
    9. East Northamptonshire Comunity Network
      United Kingdom - 79.170.40.246
      Server software: Apache/2.4.23 (Unix)
      Technology: Html
      Number of meta tags: 1
    10. Сайт надёжно припаркован и ожидает открытия
      Russian Federation - 37.140.192.104
      Server software: nginx
      Technology: CSS, Html, Html5
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites